PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G248700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 646aa    MW: 68126.3 Da    PI: 9.3141
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G248700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.12e-13174235162
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++ +  e a+l+++
  Sevir.3G248700.1.p 174 EEDKRRTARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSKISFIVAENATLRQQ 235
                         5677899*********************************999******9999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-14173238IPR004827Basic-leucine zipper domain
PfamPF001702.0E-11175236IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.071176236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-16178236No hitNo description
SuperFamilySSF579596.25E-12178236No hitNo description
CDDcd147043.97E-20179230No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MAEPALLDPS PFDLRHYPTH IFDPDLPLAG GDLPLEFAGD DGLDFDLPVD FSIDDFLLRS  60
PDRGGDGDDS GEGSAAGSGP AASSSASPAT SAANSAVANA GDREVKHEDS DEGRSGAAPS  120
WSLKRKQASP GASSDGVKCR RSGDGELSPS VSASASASRA AAEDSDERGA GGEEEDKRRT  180
ARLMRNRESA QLSRQRKKRY VEELEEKVKS MHSVINDLNS KISFIVAENA TLRQQLGGGG  240
VSAPPPGVYP PPPLPGIHFP WVPGYAMRPH GSHVPLVPIP RLKPQQAAAA AKVSKKPEVK  300
KTVENKSKTK TKKVASVSLL GLLFVALIFG AFVPGFNHNF GMSGRRNDVM FGNFGHSDAR  360
VFSVTNHGKG PKGGLNSSDM TDTDPGMMTG NSDGAGQKHR PAHNSSEILP ALLYVPRNGK  420
HVKINGNLII HSVLASEKAV AHRASNGQSV KDHKETSVAI ARYLSPSGKD ENSKGTFPPD  480
AALPQWFREG MEGPILNSGM CSEVFQFDIS AASAKSGGII PASPTVNSSS VNATQKIPKS  540
GGKLKNRRIM YNEAIPLTGK TVNSTEPRTF NSTSESSKVP DSKPASSVVV SVLADPREAG  600
NGDGDPRVSP KPLSRIFVVV LLDGVRYVTY SCTLPFKSAS PHLVN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176198KRRTARLMRNRESAQLSRQRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962093.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLK3Z4H40.0K3Z4H4_SETIT; Uncharacterized protein
STRINGSi021442m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56660.16e-89basic region/leucine zipper motif protein 49